Allele Report for F*01:01:01:01

F*01:01:01:01 View HGVS Report
Pre-2010 Nomenclature: F*01010101 Local Names: None
IMGT/HLA Acc No: HLA01096 OMIM Entry: *143110
Assigned: 1999-05-01 Sequence Last Modified: 1999-08-06
Source Entries: AF523287 , AF523288 , AY253270 , AY253271 , X17093  
Cells Sequence Derived From: H58002 , LCL721 , WDV , WT24  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Pyo CW et al. Immunogenetics 58:241-51 2006. (View abstract)
Geraghty DE et al. J Exp Med 171:1-18 1990. (View abstract)
He X et al. Tissue Antigens 63:181-3 2004. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 4 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (362 aa)
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQY
WEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTV
AQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVT
GAVVAAVMWRKKSSDRNRGSYSQAAVTDSAQGSGVSLTANKV
Nucleotide Sequence Data (1089 bps)
ATGGCGCCCCGAAGCCTCCTCCTGCTGCTCTCAGGGGCCCTGGCCCTGACCGATACTTGGGCGGGCTCCCACTCCTTGAG
GTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACATCGCCGTGGAGTACGTAGACGACACGCAAT
TCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAGCCGTGGGTGGAGCAAGAGGGGCCGCAGTAT
TGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGACTGACCGAGTGGCCCTGAGGAACCTGCTCCGCCGCTACAA
CCAGAGCGAGGCTGGGTCTCACACCCTCCAGGGAATGAATGGCTGCGACATGGGGCCCGACGGACGCCTCCTCCGCGGGT
ATCACCAGCACGCGTACGACGGCAAGGATTACATCTCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCGGACACCGTG
GCTCAGATCACCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAGGAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGA
GTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCGCGCAGATCCTCCAAAGGCACACGTTGCCCACCACC
CCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACGCTGACCTGGCAGCGG
GATGGGGAGGAACAGACCCAGGACACAGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCCGC
TGTGGTGGTGCCTTCTGGAGAGGAACAGAGATACACATGCCATGTGCAGCACGAGGGGCTGCCCCAGCCCCTCATCCTGA
GATGGGAGCAGTCTCCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTTGTTGTCCTTGGAGCTGTGGTCACT
GGAGCTGTGGTCGCTGCTGTGATGTGGAGGAAGAAGAGCTCAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAGTCAC
TGACAGTGCCCAGGGCTCTGGGGTGTCTCTCACAGCTAATAAAGTGTGA
Genomic Sequence Data (3550 bps)
GGGAGGGGGAGGGCAAAGTCCCAGGGCCCCAGGAGTGGCTCTCAAGGGCTCAGGCCCCGAGGCGGTGTCTGGGGTTGGAA
GGCTCAGTATTGAGAATTCCCCATCTCCCCAGAGTTTCTCTTTCTCTCCCAACCCGTGTCAGGTCCTTCATCCTGGATAC
TCATAACGCGGCCCCATTTCTCACTCCCATTGGGCGTCGCGTTTCTAGAGAAGCCAATCAGTGTCGCCGCAGTTCCCAGG
TTCTAAAGTCCCACGCACCCCGCGGGACTCATATTTTTCCCAGACGCGGAGGTTGGGGTCATGGCGCCCCGAAGCCTCCT
CCTGCTGCTCTCAGGGGCCCTGGCCCTGACCGATACTTGGGCGGGTGAGTGCGGGGTCCAGAGAGAAACGGCCTCTGTGG
GGAGGAGTGAGGGGCCCGCCCGGTGGGGGCGCAGGACTCAGGGAGCCGCGCCCGGAGGAGGGTCTGGCGGGTCTCAGCCC
CTCCTCGCCCCCAGGCTCCCACTCCTTGAGGTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACA
TCGCCGTGGAGTACGTAGACGACACGCAATTCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAG
CCGTGGGTGGAGCAAGAGGGGCCGCAGTATTGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGACTGACCGAGT
GGCCCTGAGGAACCTGCTCCGCCGCTACAACCAGAGCGAGGCTGGTGAGTGAACCCGGCCGGGGGCGCAGGTCACGACCA
CCCCCCATCCGCCACGGACCGCCCGGGTCCCCCCGAGTCTCCGGATCCGAAATCTACCCCGAGGCAGCGGGACCCGCCCA
GACCCTCCACCCGGGAGAGTCCCAGGCGCCTTTACCGAGGTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGGCG
GGGAGGGGGCGGGGCTAGCTGGGCGGGGCTGACTGCGGGGACCGGCTAGGGTCTCACACCCTCCAGGGAATGAATGGCTG
CGACATGGGGCCCGACGGACGCCTCCTCCGCGGGTATCACCAGCACGCGTACGACGGCAAGGATTACATCTCCCTGAACG
AGGACCTGCGCTCCTGGACCGCGGCGGACACCGTGGCTCAGATCACCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAG
GAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGAGTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCG
CGCAGGTACCAGGGGCCATGGGCGCCTTCCCTATCTCCTGTAGATCTCTTGGGATGGCCTCGCACAAGGTTGGGAGGAAA
GTGGGCCCAATGCTAGGATATCGCCCTCCCTCTAGTCCTGAGTAGGAAGAATCTTCCTGGCTTTCGAGATCCGGTACCAG
AGAGTGACTGTGAGAGTCCGCCCTGCTCTCTGGGACAATTAAGGGATGAAATCTCTGAGGGAATGGAGGGAAGACAGTCC
CTGGAATACCGATCCGCGGTCCCCTTTGAGCCCTCCAACAGCCTTGGGCCCCGTGACTTTTCTCTCAAGTTTTGTTCTCT
GCCTCACACTCAATGTGTTTGGGGCTCTGATTCCAGTCCCTCGGCCTCCACTTAGGTCAGGGCCAGAAGTCCCTGCTCCC
CACTCAGAGACTCGAACTTTCCAAGGAATAGGAGATTTTCCCAGGTGTCTGTGTCCAGGCTGGTGTCTGGGTTCTGTGCT
CCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGTTGGTCACATGGGTGCTGCTGGGGTTTCCCATGAGGAGTGCAAA
GTGCCTGAATTTTCTGACTCTTCTCAGATCCTCCAAAGGCACACGTTGCCCACCACCCCATCTCTGACCATGAGGCCACC
CTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACGCTGACCTGGCAGCGGGATGGGGAGGAACAGACCCAGGA
CACAGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCCGCTGTGGTGGTGCCTTCTGGAGAGG
AACAGAGATACACATGCCATGTGCAGCACGAGGGGCTGCCCCAGCCCCTCATCCTGAGATGGGGTAAGGAGGGAGATGGG
TAAAGAGGGGAACGAGGGGTCATGTCTTTTCTCAGGGAAAGCAGGAGCCCTTCTGGAGCTCTTCAGCAGGGTCAGGGCTG
AGGCCTGGAGATCAGGGCCCCTCACCTTCCCTTCCTTTCCCAGAGCAGTCTCCCCAGCCCACCATCCCCATCGTGGGCAT
CGTTGCTGGCCTTGTTGTCCTTGGAGCTGTGGTCACTGGAGCTGTGGTCGCTGCTGTGATGTGGAGGAAGAAGAGCTCAG
GTAGGAAGGGGTGAGGAGTGGAGTCTGAGTTTTCTTGTCCCACTGGGGGTTGCAAGCCCCAAGTAGAAGTGTGCCCTGCC
TCATTACTGGGAAGCACCATCCACACTCATGGGTCTACCCAGCCTGGGCCCTGTGTGCCAGCACCTACTCATTTGTAAAG
CTCCTGTGAAAATGAAGGACAGATTCTTCACTTCGATGATTATGGTGGTGATGGGACCTGATCCCAGCAGTCACAAATCA
CAGGGGAAGGTCCCTGCTGATGACAGACCTCAGGAGGGCAGTTGGTCCAGGACCCACATCTGCTTTCTTCATATTTCTTG
ATCCTGCCCTGGATCTACAGTTACACTTTTCTGGAAACTTCTCTGGGATCAAAGACTAGGGGTTTGCTCTAGGACCTTAT
GGCCCTGCCTCCTTTCTGGCCTCTCACAGGACATTTTCTTCCCATAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAG
GTAAGATGAAGGAGGCTGATCCCTGAGATTGTTGGGATATTGTGGTCAGGAGCCTATGAGGGAGCTCACCCACCCCACAG
TTCCTCTAGCCACATCTGTGGGCTCTGACCAGGTCCTGTTTTTGTTCTACCCCAATCACTGACAGTGCCCAGGGCTCTGG
GGTGTCTCTCACAGCTAATAAAGGTGACACTCCAGGGCAGGGGCCCTGATGTGAGTGGGGTGTTGGGGGGGAACAGAGGG
GACTCAGCTGTGCTATTGGGTTTCTTTGACTTGGATGTCTTGAGCATGAAATGGGCTATTTAGAGTGTTACCTCTCACTG
TGACTGATACGAATTTGTTCATGAATATTTTCTCTATAGTGTGAGACAGCTTCCTTGTGTGGGACTGAGAAGCAAGATAT
CAATGTAGCAGAATTGCACTTGTGCCTCACGAACATACATAAATTTTAAAAATAAAGAATAAAAATATATCTTTTTATAG
ATACAGGTAGATATGTTTTTATAGCATGCACGTAAATGTGTGTGTGTGTGTGTGTGTGTGTGAAGAGAAAGAGTGAATAG
AGAGATTAAGATTCTTTTAATGGTGAAAAGATATACATATATTTGGAATTAGCCAGCTTGACTCAGTTTAGGTGATCCCA
ATTTTGGTGGCAACAACCAAAGCATCGTAG

IMGT/HLA

Sponsors

Animated Sponsors Logo