Allele Report for E*01:03:02:02

E*01:03:02:02 View HGVS Report
Pre-2010 Nomenclature: Local Names: OTTHUMG00000149447
IMGT/HLA Acc No: HLA05913 OMIM Entry: *143010
Assigned: 2010-10-31 Sequence Last Modified: 2011-01-14
Source Entries: CR936916  
Cells Sequence Derived From:  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 0 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (358 aa)
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEY
WDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTA
AQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQ
DGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVS
GAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL
Nucleotide Sequence Data (1077 bps)
ATGGTAGATGGAACCCTCCTTTTACTCCTCTCGGAGGCCCTGGCCCTTACCCAGACCTGGGCGGGCTCCCACTCCTTGAA
GTATTTCCACACTTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCTGTGGGCTACGTGGACGACACCCAGT
TCGTGCGCTTCGACAACGACGCCGCGAGTCCGAGGATGGTGCCGCGGGCGCCGTGGATGGAGCAGGAGGGGTCAGAGTAT
TGGGACCGGGAGACACGGAGCGCCAGGGACACCGCACAGATTTTCCGAGTGAATCTGCGGACGCTGCGCGGCTACTACAA
TCAGAGCGAGGCCGGGTCTCACACCCTGCAGTGGATGCATGGCTGCGAGCTGGGGCCCGACGGGCGCTTCCTCCGCGGGT
ATGAACAGTTCGCCTACGACGGCAAGGATTATCTCACCCTGAATGAGGACCTGCGCTCCTGGACCGCGGTGGACACGGCG
GCTCAGATCTCCGAGCAAAAGTCAAATGATGCCTCTGAGGCGGAGCACCAGAGAGCCTACCTGGAAGACACATGCGTGGA
GTGGCTCCACAAATACCTGGAGAAGGGGAAGGAGACGCTGCTTCACCTGGAGCCCCCAAAGACACACGTGACTCACCACC
CCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCAG
GATGGGGAGGGCCATACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCAGC
TGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTACCCGAGCCCGTCACCCTGA
GATGGAAGCCGGCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTGGTTCTCCTTGGATCTGTGGTCTCT
GGAGCTGTGGTTGCTGCTGTGATATGGAGGAAGAAGAGCTCAGGTGGAAAAGGAGGGAGCTACTCTAAGGCTGAGTGGAG
CGACAGTGCCCAGGGGTCTGAGTCTCACAGCTTGTAA
Genomic Sequence Data (3822 bps)
CAAAGTGCTGAGATTACAGGCGTGAGCCACCGCGCCCAGCCAGGACTAATTTCTAAGAGTGTGCAGAGATACCGAAACCT
AAAAGTTTAAGAACTGCTGATTGCTGGGAAACTCTGCAGTTTCCCGTTCCTCTCGTAACCTGGTCATGTGTCCTTCTTCC
TGGATACTCATGACGCAGACTCAGTTCTCATTCCCAATGGGTGTCGGGTTTCTAGAGAAGCCAATCAGCGTCGCCACGAC
TCCCGACTATAAAGTCCCCATCCGGACTCAAGAAGTTCTCAGGACTCAGAGGCTGGGATCATGGTAGATGGAACCCTCCT
TTTACTCCTCTCGGAGGCCCTGGCCCTTACCCAGACCTGGGCGGGTGAGTGCGGGGTCGGGATGGAAACGGCCTCTACCG
GGAGTAGAGAGGGGCCGGCCCGGCGGGGGCGAAGGACTCGGGGAGCCGCGCCGGGAGGAGGGTCGGGCCGATCTCAGCCC
CTCCTCGCCCCCAGGCTCCCACTCCTTGAAGTATTTCCACACTTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCA
TCTCTGTGGGCTACGTGGACGACACCCAGTTCGTGCGCTTCGACAACGACGCCGCGAGTCCGAGGATGGTGCCGCGGGCG
CCGTGGATGGAGCAGGAGGGGTCAGAGTATTGGGACCGGGAGACACGGAGCGCCAGGGACACCGCACAGATTTTCCGAGT
GAATCTGCGGACGCTGCGCGGCTACTACAATCAGAGCGAGGCCGGTGAGTGACCCCGGCCAGGGGAGCAGGTCACGACCC
CTCCCCATCCCCCACGGACGGCGCGGGTCCCCTCGAATCTTCGGGTCCCAGATTCACCCCAAGGCTGCGGAACCCGCCCA
GACCCTAGACCGGGGAGAGTCTCAGGCGCCTTTACCCGGTTCTTTTTCAGTTTAGGCCAAAATGCCCACAGGGTGGTGGC
GACGGGGGCGGGGCTTGGTGGGCGGGACTGACTAAGGGGCGGGGCCAGGGTCTCACACCCTGCAGTGGATGCATGGCTGC
GAGCTGGGGCCCGACGGGCGCTTCCTCCGCGGGTATGAACAGTTCGCCTACGACGGCAAGGATTATCTCACCCTGAATGA
GGACCTGCGCTCCTGGACCGCGGTGGACACGGCGGCTCAGATCTCCGAGCAAAAGTCAAATGATGCCTCTGAGGCGGAGC
ACCAGAGAGCCTACCTGGAAGACACATGCGTGGAGTGGCTCCACAAATACCTGGAGAAGGGGAAGGAGACGCTGCTTCAC
CTGGGTAAGAGGGTCCACAGGGCTACTCTCCCAACTCCTTCTTGGGCTAGGACTGTGCCCACAGCTGACAGACCTCAAAC
AGTAGAAGAAACAGGGATGGAGGCCAGAATACCACTCCTCCCTTGGATCAGGAGAGGGAGCTGTCACCTGAGGTACAGGA
GATCCTATACCACAGAGTGACTCTCTTAAAGGGCCAGACCTCTCTCAGGGGCAATTAAGGAATCTAGTCTCGCTGGAGAT
TCCATCCTTCAGATGAACTGATGAGCAGTTCTCTTTGACTCCCAGTATTAGGAATCACGGGGGAGTTTCTCTCGTGCCTG
ATTCTCAGCCCCACACCAAGAGTTTTTGGAGGTCTGACTCCAGCTTTTCTCAGTCACTCAGCATCCACACAGGCCAGGAC
CAGAAATCCCTTTTCACCTTCTACCCTGGGCTAGCTCATCCCGATTCTAGAACTTTCCAAGGAATAAGAGGCTATCCCAG
ATCCCTAAGTCCAGGCTGGTGTCAAGGTTTTGTCCTCTTCTCCTACTATAATTGTCCTCTTCCTTCTCAGGATGGTCACA
TGGGTGCTGCTGGAGTGTCCCATGAGAGATACAAAGTGCCTGAATTTTCTGACTCTTCCCCTCAGAGCCCCCAAAGACAC
ACGTGACTCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACA
CTGACCTGGCAGCAGGATGGGGAGGGCCATACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTT
CCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTACCCG
AGCCCGTCACCCTGAGATGGAGTAAGGAGGGGGATGGGAGGTCATGTCTCTTCTCAGGGAAAGCGGGAGCCCTTCTGGAG
CCCTTCCGCAGGGTCAGGGCTGAGGCCTGGGGGTCAGGGCCCCTTACGTTCCCCTCTTTTCCCAGAGCCGGCTTCCCAGC
CCACCATCCCCATCGTGGGCATCATTGCTGGCCTGGTTCTCCTTGGATCTGTGGTCTCTGGAGCTGTGGTTGCTGCTGTG
ATATGGAGGAAGAAGAGCTCAGGTGGGGAAGGGAGAAGGGTGGGGTCTGAGTTTTCTTGTCCCACTGGGTGTTTCAAGCC
CTAGGTAAAAGTGTGTCCTGCCTCGTTACTGGGAAGCACCATCCACACACACGAGCCTACCCAGCCTGGGGCCCTGTGTG
CCAGCACCTACTCTTTTTTTTTGAGACGGAGTCTTGGCTCTGTCACCCAGGCTGGAGTGCAATGGCGTGGTTTCAGCTCA
CTGCAACCTCCGCCTCCCAGGTTCAAGCAATTCTCCTGCCTCAGCCTCCCTAGTAGCTGGGACTACACATGCGTGCCACC
ACACCTGGCTAATTTTTTTTTTTGTATTTTTAGTGGAGATGGGGTTTCACTATGTTGGCCAGGCTGGTCTCGAACTCCTG
ACTTTGTGATCTGCCTGCCTCGGCCTCCCAAAGTGCTGGGATTACAGTCGTGAGCCACCGCACCCAGCCGCACCTACTCT
TTTGTAAAGCACCTGTGACAATGAAGGACAGATTTATCACCTTGACGATTGTGGTGATGGGGACCTGATCCCAGCAGTCA
CAGGTCACAGGGGAAGGTCCCTGCTGAAGACAGACCTCAGAAGGGCAGTTGATCCAGGACCCACACCTGCTTTCTTCACG
TTTCCTGATCCTGCCCTGGGTCTGCAGTCACAGTTCAGGAAACTTCTCTGGGATCCAAAACTAGGAGGTTCCTCTAGGAC
CTTATGGCCCTGCCTCCTCCCTGGCCCCTCACAGGACATTTTCTTCCAACAGGTGGAAAAGGAGGGAGCTACTCTAAGGC
TGAGTGTAAGTGCGGGGCGGGAGCGTGGAGGAGCTCGCCCACCCTATAATTCCTCCTGCACCACATCTCCTGTGGGCTCT
GACCAGGTCTTGTTTTTGTTCTACCCCAGGGAGCGACAGTGCCCAGGGGTCTGAGTCTCACAGCTTGTAAAGGTGAGATT
CTGGGGGTCTGAAGTGGGTGGAGGGTGGGGCAGAGGGGACAGGACTGGGTTGTGGGGATTTTTTGATTCAGAATTTTTGA
GTGTGTGGTGGGCTGTTCAGAGTGTCATCACTTACCGTGACTGACCTGAATTTGTTCATGACTATTTTCTTCTGTAGCCT
GAGACAGCTGCCTTGTGTGCGACTGAGATGCACAGCTGCCTTGTGTGCGACTGAGATGCAGGATTTCCTCACGCCTCCCC
TATGTGTCTTAGGGGACTCTGGCTTCTCTTTTTGCAAGGGCCTCTGAATCTGTCTGTGTCCCTGTTAGCACAATGTGAGG
AGGTAGAGAAACAGTCCACCTCTGTGTCTACCATGACCCCCTTCCTCACACTGACCTGTGTTCCTTCCCTGTTCTCTTTT
CTATTAAAAATAAGAACCTGGGCAGAGTGCGGCAGCTCATGCCTGTAATCCCAGCACTTAGG

IMGT/HLA

Sponsors

Animated Sponsors Logo