Allele Report for E*01:03:01:01

E*01:03:01:01 View HGVS Report
Pre-2010 Nomenclature: E*01030101 Local Names: E*01031, E*01C230, E*N3, HLA-E*010301Afr-Am024
IMGT/HLA Acc No: HLA00936 OMIM Entry: *143010
Assigned: 1990-11-04 Sequence Last Modified: 2005-07-12
Source Entries: AJ002533 , AJ002534 , AY216681 , AY645731 , AY645733 , AY645736 , L78455 , M32507 , X87678 , X87679  
Cells Sequence Derived From: 1408-1014 , 1416-1186 , CHI009 , CR , H58002 , JFE , JHUAA1143 , MH , MT-(2) , SPAARN70 , TK  
Known Ethnic Origin Of Source: Black, Caucasoid, Oriental
Publications
Gomez-Casado E et al. Hum Immunol 54:69-73 1997. (View abstract)
Pyo CW et al. Immunogenetics 58:241-51 2006. (View abstract)
Ohya K et al. Immunogenetics 32:205-9 1990. (View abstract)
Steffensen R et al. Tissue Antigens 52:569-72 1998. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 11 Laboratories: 6
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (358 aa)
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEY
WDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTA
AQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQ
DGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVS
GAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL
Nucleotide Sequence Data (1077 bps)
ATGGTAGATGGAACCCTCCTTTTACTCCTCTCGGAGGCCCTGGCCCTTACCCAGACCTGGGCGGGCTCCCACTCCTTGAA
GTATTTCCACACTTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCTGTGGGCTACGTGGACGACACCCAGT
TCGTGCGCTTCGACAACGACGCCGCGAGTCCGAGGATGGTGCCGCGGGCGCCGTGGATGGAGCAGGAGGGGTCAGAGTAT
TGGGACCGGGAGACACGGAGCGCCAGGGACACCGCACAGATTTTCCGAGTGAACCTGCGGACGCTGCGCGGCTACTACAA
TCAGAGCGAGGCCGGGTCTCACACCCTGCAGTGGATGCATGGCTGCGAGCTGGGGCCCGACGGGCGCTTCCTCCGCGGGT
ATGAACAGTTCGCCTACGACGGCAAGGATTATCTCACCCTGAATGAGGACCTGCGCTCCTGGACCGCGGTGGACACGGCG
GCTCAGATCTCCGAGCAAAAGTCAAATGATGCCTCTGAGGCGGAGCACCAGAGAGCCTACCTGGAAGACACATGCGTGGA
GTGGCTCCACAAATACCTGGAGAAGGGGAAGGAGACGCTGCTTCACCTGGAGCCCCCAAAGACACACGTGACTCACCACC
CCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCAG
GATGGGGAGGGCCATACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCAGC
TGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTACCCGAGCCCGTCACCCTGA
GATGGAAGCCGGCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTGGTTCTCCTTGGATCTGTGGTCTCT
GGAGCTGTGGTTGCTGCTGTGATATGGAGGAAGAAGAGCTCAGGTGGAAAAGGAGGGAGCTACTCTAAGGCTGAGTGGAG
CGACAGTGCCCAGGGGTCTGAGTCTCACAGCTTGTAA
Genomic Sequence Data (3822 bps)
CAAAGTGCTGAGATTACAGGCGTGAGCCACCGCGCCCAGCCAGGACTAATTTCTAAGAGTGTGCAGAGATACCGAAACCT
AAAAGTTTAAGAACTGCTGATTGCTGGGAAACTCTGCAGTTTCCCGTTCCTCTCGTAACCTGGTCATGTGTCCTTCTTCC
TGGATACTCATGACGCAGACTCAGTTCTCATTCCCAATGGGTGTCGGGTTTCTAGAGAAGCCAATCAGCGTCGCCACGAC
TCCCGACTATAAAGTCCCCATCCGGACTCAAGAAGTTCTCAGGACTCAGAGGCTGGGATCATGGTAGATGGAACCCTCCT
TTTACTCCTCTCGGAGGCCCTGGCCCTTACCCAGACCTGGGCGGGTGAGTGCGGGGTCGGGATGGAAACGGCCTCTACCG
GGAGTAGAGAGGGGCCGGCCCGGCGGGGGCGAAGGACTCGGGGAGCCGCGCCGGGAGGAGGGTCGGGCCGATCTCAGCCC
CTCCTCGCCCCCAGGCTCCCACTCCTTGAAGTATTTCCACACTTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCA
TCTCTGTGGGCTACGTGGACGACACCCAGTTCGTGCGCTTCGACAACGACGCCGCGAGTCCGAGGATGGTGCCGCGGGCG
CCGTGGATGGAGCAGGAGGGGTCAGAGTATTGGGACCGGGAGACACGGAGCGCCAGGGACACCGCACAGATTTTCCGAGT
GAACCTGCGGACGCTGCGCGGCTACTACAATCAGAGCGAGGCCGGTGAGTGACCCCGGCCAGGGGAGCAGGTCACGACCC
CTCCCCATCCCCCACGGACGGCGCGGGTCCCCTCGAATCTTCGGGTCCCAGATTCACCCCAAGGCTGCGGAACCCGCCCA
GACCCTAGACCGGGGAGAGTCTCAGGCGCCTTTACCCGGTTCTTTTTCAGTTTAGGCCAAAATGCCCACAGGGTGGTGGC
GACGGGGGCGGGGCTTGGTGGGCGGGACTGACTAAGGGGCGGGGCCAGGGTCTCACACCCTGCAGTGGATGCATGGCTGC
GAGCTGGGGCCCGACGGGCGCTTCCTCCGCGGGTATGAACAGTTCGCCTACGACGGCAAGGATTATCTCACCCTGAATGA
GGACCTGCGCTCCTGGACCGCGGTGGACACGGCGGCTCAGATCTCCGAGCAAAAGTCAAATGATGCCTCTGAGGCGGAGC
ACCAGAGAGCCTACCTGGAAGACACATGCGTGGAGTGGCTCCACAAATACCTGGAGAAGGGGAAGGAGACGCTGCTTCAC
CTGGGTAAGAGGGTCCACAGGGCTACTCTCCCATCTCCTTCTTGGGCTAGGACTGTGCCCACAGCTGACAGACCTCAAAC
AGTAGAAGAAACAGGGATGGAGGCCAGAATACCACTCCTCCCTTGGATCAGGAGAGGGAGCTGTCACCTGAGGTACAGGA
GATCCTATACCACAGAGTGACTCTCTTAAAGGGCCAGACCTCTCTCAGGGGCAATTAAGGAATCTAGTCTCGCTGGAGAT
TCCATCCTTCAGATGAACTGATGAGCAGTTCTCTTTGACTCCCAGTATTAGGAATCACGGGGGAGTTTCTCTCGTGCCTG
ATTCTCAGCCCCACACCAAGAGTTTTTGGAGGTCTGACTCCAGCTTTTCTCAGTCACTCAGCATCCACACAGGCCAGGAC
CAGAAATCCCTTTTCACCTTCTACCCTGGGCTAGCTCATCCCGATTCTAGAACTTTCCAAGGAATAAGAGGCTATCCCAG
ATCCCTAAGTCCAGGCTGGTGTCAAGGTTTTGTCCTCTTCTCCTACTATAATTGTCCTCTTCCTTCTCAGGATGGTCACA
TGGGTGCTGCTGGAGTGTCCCATGAGAGATACAAAGTGCCTGAATTTTCTGACTCTTCCCCTCAGAGCCCCCAAAGACAC
ACGTGACTCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACA
CTGACCTGGCAGCAGGATGGGGAGGGCCATACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTT
CCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTACCCG
AGCCCGTCACCCTGAGATGGAGTAAGGAGGGGGATGGGAGGTCATGTCTCTTCTCAGGGAAAGCGGGAGCCCTTCTGGAG
CCCTTCCGCAGGGTCAGGGCTGAGGCCTGGGGGTCAGGGCCCCTTACGTTCCCCTCTTTTCCCAGAGCCGGCTTCCCAGC
CCACCATCCCCATCGTGGGCATCATTGCTGGCCTGGTTCTCCTTGGATCTGTGGTCTCTGGAGCTGTGGTTGCTGCTGTG
ATATGGAGGAAGAAGAGCTCAGGTGGGGAAGGGAGAAGGGTGGGGTCTGAGTTTTCTTGTCCCACTGGGTGTTTCAAGCC
CTAGGTAAAAGTGTGTCCTGCCTCGTTACTGGGAAGCACCATCCACACACACGAGCCTACCCAGCCTGGGGCCCTGTGTG
CCAGCACCTACTCTTTTTTTTTGAGACGGAGTCTTGGCTCTGTCACCCAGGCTGGAGTGCAATGGCGTGGTTTCAGCTCA
CTGCAACCTCCGCCTCCCAGGTTCAAGCAATTCTCCTGCCTCAGCCTCCCTAGTAGCTGGGACTACACATGCGTGCCACC
ACACCTGGCTAATTTTTTTTTTTGTATTTTTAGTGGAGATGGGGTTTCACTATGTTGGCCAGGCTGGTCTCGAACTCCTG
ACTTTGTGATCTGCCTGCCTCGGCCTCCCAAAGTGCTGGGATTACAGTCGTGAGCCACCGCACCCAGCCGCACCTACTCT
TTTGTAAAGCACCTGTGACAATGAAGGACAGATTTATCACCTTGACGATTGTGGTGATGGGGACCTGATCCCAGCAGTCA
CAGGTCACAGGGGAAGGTCCCTGCTGAAGACAGACCTCAGAAGGGCAGTTGATCCAGGACCCACACCTGCTTTCTTCACG
TTTCCTGATCCTGCCCTGGGTCTGCAGTCACAGTTCAGGAAACTTCTCTGGGATCCAAAACTAGGAGGTTCCTCTAGGAC
CTTATGGCCCTGCCTCCTCCCTGGCCCCTCACAGGACATTTTCTTCCAACAGGTGGAAAAGGAGGGAGCTACTCTAAGGC
TGAGTGTAAGTGCGGGGCGGGAGCGTGGAGGAGCTCGCCCACCCTATAATTCCTCCTGCACCACATCTCCTGTGGGCTCT
GACCAGGTCTTGTTTTTGTTCTACCCCAGGGAGCGACAGTGCCCAGGGGTCTGAGTCTCACAGCTTGTAAAGGTGAGATT
CTGGGGGTCTGAAGTGGGTGGAGGGTGGGGCAGAGGGGACAGGACTGGGTTGTGGGGATTTTTTGATTCAGAATTTTTGA
GTGTGTGGTGGGCTGTTCAGAGTGTCATCACTTACCGTGACTGACCTGAATTTGTTCATGACTATTTTCTTCTGTAGCCT
GAGACAGCTGCCTTGTGTGCGACTGAGATGCACAGCTGCCTTGTGTGCGACTGAGATGCAGGATTTCCTCACGCCTCCCC
TATGTGTCTTAGGGGACTCTGGCTTCTCTTTTTGCAAGGGCCTCTGAATCTGTCTGTGTCCCTGTTAGCACAATGTGAGG
AGGTAGAGAAACAGTCCACCTCTGTGTCTACCATGACCCCCTTCCTCACACTGACCTGTGTTCCTTCCCTGTTCTCTTTT
CTATTAAAAATAAGAACCTGGGCAGAGTGCGGCAGCTCATGCCTGTAATCCCAGCACTTAGG

IMGT/HLA

Sponsors

Animated Sponsors Logo