Allele Report for DRB5*01:10N

DRB5*01:10N View HGVS Report
Pre-2010 Nomenclature: DRB5*0110N Local Names: DRB5*0102Null
IMGT/HLA Acc No: HLA01012 OMIM Entry: *604776
Assigned: 1998-12-09 Sequence Last Modified: 2001-04-09
Source Entries: AF097680 , AF314541  
Cells Sequence Derived From: CB848 , JAS  
Known Ethnic Origin Of Source: Caucasoid
Publications
Balas A et al. Tissue Antigens 55:467-9 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: Not expressed WHO Assigned Type: Null
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 1 Refer to Comments
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR51 [55], false positive assignments
Comments:
Protein Sequence (81 aa)
RFLQQDKYECHFFNGTERVRFLHRGIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCTQLRGW
X
Nucleotide Sequence Data (268 bps)
CACGTTTCTTGCAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGCACAGAGGCATC
TATAACCAAGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGCGCCGCGGTGGACACCTACTGCACACAACTACGGGGTT
GGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo