Allele Report for DRB5*01:01:01

DRB5*01:01:01 View HGVS Report
Pre-2010 Nomenclature: DRB5*010101 Local Names: DRB5*01011, DR2 Dw2a, DR2a
IMGT/HLA Acc No: HLA00915 OMIM Entry: *604776
Assigned: 1989-08-01 Sequence Last Modified: 1999-04-08
Source Entries: AL713966 , AM159646 , M16954 , M17377 , M20429  
Cells Sequence Derived From: MHHZ-00020722 , PGF , ROF-NL  
Known Ethnic Origin Of Source: Caucasoid
Publications
Bell JI et al. Proc Natl Acad Sci U S A 84:6234-8 1987. (View abstract)
Lock CB et al. Immunogenetics 27:449-55 1988. (View abstract)
Lee BS et al. Proc Natl Acad Sci U S A 84:4591-5 1987. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 5
HLA Dictionary Data
Expert Assigned Type: DR51 WHO Assigned Type: DR51
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 41 DR51 [82-100%]
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (266 aa)
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVT
ELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVRW
FRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFKNQKGHSGLHPTGLVS
Nucleotide Sequence Data (801 bps)
ATGGTGTGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAAAGCTGACAGTGACACTGATGGTGCTGAGCTCCCCACTGGC
TTTGGCTGGGGACACCCGACCACGTTTCTTGCAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGC
GGTTCCTGCACAGAGACATCTATAACCAAGAGGAGGACTTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACG
GAGCTGGGGCGGCCTGACGCTGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGCGCCGCGGTGGACACCTA
CTGCAGACACAACTACGGGGTTGGTGAGAGCTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTGCAA
GGACCCAGACCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGG
TTCCGGAACAGCCAGGAAGAGAAGGCTGGGGTGGTGTCCACAGGCCTGATTCAGAATGGAGACTGGACCTTCCAGACCCT
GGTGATGCTGGAAACAGTTCCTCGAAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCA
CAGTGGAATGGAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGGGCTTTGTGCTGGGCCTGCTC
TTCCTTGGGGCCGGGCTATTCATCTACTTCAAGAATCAGAAAGGGCACTCTGGACTTCACCCAACAGGACTCGTGAGCTG
A
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo