Allele Report for DRB4*01:08

DRB4*01:08 View HGVS Report
Pre-2010 Nomenclature: DRB4*0108 Local Names: DRB4New
IMGT/HLA Acc No: HLA04572 OMIM Entry: Not Listed
Assigned: 2009-11-30 Sequence Last Modified: 2010-01-15
Source Entries: AB510591  
Cells Sequence Derived From: Tokushima  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Lee E et al. Tissue Antigens 78:158-159 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGV
VKSFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGCTAAGTGTGAGTGTCATTTCCTCAATGGGACGGAGCGAGTGTGGAACCTGATCAGATACATC
TATAACCAAGAGGAGTACGCGCGCTACAACAGTGACCTGGGGGAGTACCAGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTACTGCAGATACAACTACGGGG
TTGTGAAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo