Allele Report for DRB4*01:06

DRB4*01:06 View HGVS Report
Pre-2010 Nomenclature: DRB4*0106 Local Names: HLA-DRB4*MKOST
IMGT/HLA Acc No: HLA01559 OMIM Entry: Not Listed
Assigned: 2001-12-20 Sequence Last Modified: 2002-01-11
Source Entries: AF450316 , AF450317 , AH011268  
Cells Sequence Derived From: MKOST  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: Undefined WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (180 aa)
RFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGV
VESFTVQRRVQPKVTVYPSKTQPLQHYNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSMMSPLT
Nucleotide Sequence Data (543 bps)
CACGTTTCTTGGAGCAGGCTAAGTGTGAGTGTCATTTCCTCAATGGGACGGAGCGAGTGTGGAACCTGATCAGATACATC
TATAACCAAGAGGAGTACGCGCGCTACAACAGTGACCTGGGGGAGTACCAGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTACTGCAGATACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
TACAACCTCCTGGTCTGCTCTGTGAATGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACAGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCATCCAAGCATGATGAGCCCTCTCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo