Allele Report for DRB3*03:01:03

DRB3*03:01:03 View HGVS Report
Pre-2010 Nomenclature: DRB3*030103 Local Names: DRB3*03New
IMGT/HLA Acc No: HLA03573 OMIM Entry: Not Listed
Assigned: 2008-12-22 Sequence Last Modified: 2009-01-09
Source Entries: FJ515277  
Cells Sequence Derived From: THAI742  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR52 WHO Assigned Type: DR52
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 41 DR52 [90-100%]
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (183 aa)
RFLELLKSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGQVDNYCRHNYGV
VESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVEW
Nucleotide Sequence Data (552 bps)
CACGTTTCTTGGAGCTGCTTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCAGGTGGACAATTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGACTGGGGTGGTGTCCACAGGCCTGATCCATAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTAGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACTTGCCAAGTGGAGCACCCAAGCGTAACGAGCCCTCTCACAGTGGAATGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo