Allele Report for DRB3*02:23

DRB3*02:23 View HGVS Report
Pre-2010 Nomenclature: DRB3*0223 Local Names: DRB3*02new
IMGT/HLA Acc No: HLA03064 OMIM Entry: Not Listed
Assigned: 2007-08-30 Sequence Last Modified: 2007-10-05
Source Entries: AM747470  
Cells Sequence Derived From: 070315  
Known Ethnic Origin Of Source: Caucasoid
Publications
Danzer M et al. Tissue Antigens 72:498-9 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAVRELGLPDAEYWNSQKDLLEQKRGQVDNYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCTGCTTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGACACTTC
CATAACCAGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGAGGGAGCTGGGGCTGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCAGGTGGACAATTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo