Allele Report for DRB3*02:20

DRB3*02:20 View HGVS Report
Pre-2010 Nomenclature: DRB3*0220 Local Names: DRB02new
IMGT/HLA Acc No: HLA02151 OMIM Entry: Not Listed
Assigned: 2005-03-22 Sequence Last Modified: 2010-01-15
Source Entries: AY958608 , FN556018  
Cells Sequence Derived From: LUMC-63140 , cr01-3558  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: Undefined WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (183 aa)
RFLELLKSECHFFNGTERVRFLERHFHNQEENVRFDSDVGEYRAVRELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGV
GESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVEW
Nucleotide Sequence Data (552 bps)
CACGTTTCTTGGAGCTGCTTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGACACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGAGGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCAGGTGGACAATTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGCTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTAGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTAACGAGCCCTCTCACAGTGGAATGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo