Allele Report for DRB3*02:09

DRB3*02:09 View HGVS Report
Pre-2010 Nomenclature: DRB3*0209 Local Names: None
IMGT/HLA Acc No: HLA01095 OMIM Entry: Not Listed
Assigned: 1999-05-17 Sequence Last Modified: 2008-10-10
Source Entries: AF132810 , AF148518  
Cells Sequence Derived From: p1454/bg287  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Morabito A et al. Tissue Antigens 56:90-4 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 1 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR52 WHO Assigned Type: DR52
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (89 aa)
RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGQVDNYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCTGCTTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGACACTTC
CATAACCAGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCAGGTGGACAATTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo