Allele Report for DRB3*02:02:05

DRB3*02:02:05 View HGVS Report
Pre-2010 Nomenclature: DRB3*020205 Local Names: HLA-DRB3*02
IMGT/HLA Acc No: HLA02637 OMIM Entry: Not Listed
Assigned: 2006-08-23 Sequence Last Modified: 2006-10-06
Source Entries: DQ309438  
Cells Sequence Derived From: 9791  
Known Ethnic Origin Of Source: Caucasoid
Publications
Curcio M et al. Tissue Antigens 68:533-4 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR52 WHO Assigned Type: DR52
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 126 DR52 [90-100%]
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (89 aa)
RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAVRELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCTGCTTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGACACTTC
CATAACCAGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGTGAGTACCGGGCGGTGAGGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCAGGTGGACAATTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo