Allele Report for DRB3*02:01

DRB3*02:01 View HGVS Report
Pre-2010 Nomenclature: DRB3*0201 Local Names: DRw6b III,
IMGT/HLA Acc No: HLA00894 OMIM Entry: Not Listed
Assigned: 1987-11-21 Sequence Last Modified: 1999-04-08
Source Entries: V00522  
Cells Sequence Derived From: 4/w6 , DM24  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Common
Publications
Todd JA et al. Nature 329:599-604 1987. (View abstract)
Gorski J et al. Nature 322:67-70 1986. (View abstract)
Long EO et al. EMBO J 2:389-4 1983. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR52 WHO Assigned Type: DR52
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 3 DR52 [97-100%]
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (266 aa)
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAVR
ELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGVVESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRW
FRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETFPRSGEVYTCQVEHPSVTSPLTVEWSARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
Nucleotide Sequence Data (801 bps)
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCAGCTTGGCAGCGTTGACAGTGACACTGATGGTGCTGAGCTCCCGACTGGC
TTTCGCTGGGGACACCCGACCACGTTTCTTGGAGCTGCTTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGC
GGTTCCTGGAGAGACACTTCCATAACCAGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGAGG
GAGCTGGGGCGGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCAGGTGGACAATTA
CTGCAGACACAACTACGGGGTTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGG
TTCCGGAACGGCCAGGAAGAGAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCTTCCAGACCCT
GGTGATGCTAGAAACATTTCCTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTAACGAGCCCTCTCA
CAGTGGAATGGAGTGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGGGCTTCGTGCTGGGCCTGCTC
TTCCTTGGGGCCGGGCTGTTCATCTACTTCAGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGCTG
A
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo