Allele Report for DRB3*01:13

DRB3*01:13 View HGVS Report
Pre-2010 Nomenclature: DRB3*0113 Local Names: DRB3*0101v-3
IMGT/HLA Acc No: HLA03434 OMIM Entry: Not Listed
Assigned: 2008-07-30 Sequence Last Modified: 2008-10-10
Source Entries: EU873153  
Cells Sequence Derived From: B07-2896  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Lee KW et al. Tissue Antigens 73:83-4 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLELRKSECHFFNGTERVRYLDRYFHNQEELLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCTGCGTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGCTCCTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAATTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo