Allele Report for DRB3*01:10

DRB3*01:10 View HGVS Report
Pre-2010 Nomenclature: DRB3*0110 Local Names: DRB3*01MGT
IMGT/HLA Acc No: HLA01518 OMIM Entry: Not Listed
Assigned: 2001-09-13 Sequence Last Modified: 2002-04-08
Source Entries: AJ315477  
Cells Sequence Derived From: CL06453  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Tavoularis S et al. Tissue Antigens 63:496-500 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR52 WHO Assigned Type: DR52
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (81 aa)
RFLELRKSECHFFNGTERVRYLDRYFHNQEEFLSFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGV
G
Nucleotide Sequence Data (246 bps)
CACGTTTCTTGGAGCTGCGTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGTTCCTGAGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAATTACTGCAGACACAACTACGGGG
TTGGTG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo