Allele Report for DRB3*01:08

DRB3*01:08 View HGVS Report
Pre-2010 Nomenclature: DRB3*0108 Local Names: 1507.33405
IMGT/HLA Acc No: HLA01462 OMIM Entry: Not Listed
Assigned: 2001-04-26 Sequence Last Modified: 2001-07-09
Source Entries: AF361865  
Cells Sequence Derived From: 1507-33405  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: Undefined WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (88 aa)
RFLELRKSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGV
GESFTVQR
Nucleotide Sequence Data (266 bps)
CACGTTTCTTGGAGCTGCGTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAATTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo