Allele Report for DRB3*01:01:05

DRB3*01:01:05 View HGVS Report
Pre-2010 Nomenclature: DRB3*010105 Local Names: DRB3*0101v-1
IMGT/HLA Acc No: HLA03432 OMIM Entry: Not Listed
Assigned: 2008-07-30 Sequence Last Modified: 2008-10-10
Source Entries: EU873151  
Cells Sequence Derived From: B07-1737 , B07-2819 , BM-4028 , H-05046  
Known Ethnic Origin Of Source: Oriental
Publications
Lee KW et al. Tissue Antigens 73:83-4 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR52 WHO Assigned Type: DR52
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 88 DR52 [90-100%]
NMDP (2008) Not tested Not tested
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (89 aa)
RFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCTGCGTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTT
CATAACCAGGAGGAGTTCCTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAATTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo