Allele Report for DRB1*16:13N

DRB1*16:13N View HGVS Report
Pre-2010 Nomenclature: DRB1*1613N Local Names: MDA-DR16N
IMGT/HLA Acc No: HLA03062 OMIM Entry: *142857
Assigned: 2007-08-30 Sequence Last Modified: 2007-10-05
Source Entries: EU078908  
Cells Sequence Derived From: MDA-DR16N  
Known Ethnic Origin Of Source: American Indian
Publications
Zhao W et al. Tissue Antigens 71:180-2 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (47 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAVTX
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGTAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGCGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo