Allele Report for DRB1*16:09:01

DRB1*16:09:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*1609 Local Names: HLA-DRB1* 16 variant
IMGT/HLA Acc No: HLA02130 OMIM Entry: *142857
Assigned: 2005-02-18 Sequence Last Modified: 2005-07-12
Source Entries: AY912074 , GQ373165  
Cells Sequence Derived From: NJ7479 , NT01110  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Miao KR et al. Tissue Antigens 66:248-50 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR16 WHO Assigned Type: DR16(2)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR16
Comments:
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGCGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo