Allele Report for DRB1*15:80N

DRB1*15:80N View HGVS Report
Pre-2010 Nomenclature: Local Names: 014591600
IMGT/HLA Acc No: HLA08583 OMIM Entry: *142857
Assigned: 2012-08-31 Sequence Last Modified: 2012-10-17
Source Entries: HE974905  
Cells Sequence Derived From: 014591600  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (82 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQK
DILEQARRGGHLLQTQLRG
WX
Nucleotide Sequence Data (268 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTT
GGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo