Allele Report for DRB1*15:69

DRB1*15:69 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-JMDP-R-017
IMGT/HLA Acc No: HLA07369 OMIM Entry: *142857
Assigned: 2011-11-28 Sequence Last Modified: 2012-01-12
Source Entries: AB677522  
Cells Sequence Derived From: JMDP36K118  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQPERECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTGAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo