Allele Report for DRB1*15:68

DRB1*15:68 View HGVS Report
Pre-2010 Nomenclature: Local Names: BY00888
IMGT/HLA Acc No: HLA07361 OMIM Entry: *142857
Assigned: 2011-10-31 Sequence Last Modified: 2012-01-12
Source Entries: JN119508 , JN383947  
Cells Sequence Derived From: BY00888 , HG00004040  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFREVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGAGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo