Allele Report for DRB1*15:37:02

DRB1*15:37:02 View HGVS Report
Pre-2010 Nomenclature: Local Names: D10128181
IMGT/HLA Acc No: HLA08593 OMIM Entry: *142857
Assigned: 2012-09-30 Sequence Last Modified: 2012-10-17
Source Entries: HE654768 , KF415269  
Cells Sequence Derived From: D10128181 , HG00007339  
Known Ethnic Origin Of Source: Unknown
Publications
Zhang C et al. Tissue Antigens 82:201-202 2013. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDNYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACAATTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo