Allele Report for DRB1*15:03:02

DRB1*15:03:02 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DR15_567_00102, HIS_NEW_DR15_913_00281, HIS_NEW_DR15_913_00263
IMGT/HLA Acc No: HLA06472 OMIM Entry: *142857
Assigned: 2011-01-31 Sequence Last Modified: 2011-04-08
Source Entries: GQ240518 , HM562348 , HQ230523 , HQ230541 , JQ824720 , JQ824721  
Cells Sequence Derived From: HG00000395 , HG00000396 , HG00000397 , HG00001856 , HG00005140 , HG00005141  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 6 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRHFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGAGGGTGCGGTTCCTGGACAGACACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo