Allele Report for DRB1*15:01:02

DRB1*15:01:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*150102 Local Names: DRB1*15012, DRB1*15MT
IMGT/HLA Acc No: HLA00866 OMIM Entry: *142857
Assigned: 1995-04-30 Sequence Last Modified: 2010-07-16
Source Entries: HM141085 , Z48359  
Cells Sequence Derived From: LD0797 , NT01201  
Known Ethnic Origin Of Source: Caucasoid
Publications
Hashemi S et al. Tissue Antigens 47:147-9 1996. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR15 WHO Assigned Type: DR15(2)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 31 DR15 [75-90%] DR2 [0-19%] DR16 [0-13%]
NMDP (2008) 6428 DR15 [76%] DR2 [23%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR2 DR15
Comments:
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGAG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo