Allele Report for DRB1*15:40

DRB1*15:40 View HGVS Report
Pre-2010 Nomenclature: DRB1*1540 Local Names: HistoGenetics HIS_NEW_DR15_221_00029
IMGT/HLA Acc No: HLA04368 OMIM Entry: *142857
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ358175 , GQ345106 , GU551920 , HM125887 , HQ230544 , HQ230546 , HQ337769 , HQ590529 , JN629073 , JQ824729  
Cells Sequence Derived From: HG00000390 , HG00000391 , HG00000392 , HG00000393 , HG00001040 , HG00001890 , HG00003375 , HG00005139 , HN-71872-3 , HN-86092-8  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 10 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQPKREYHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTATCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo