Allele Report for DRB1*15:32

DRB1*15:32 View HGVS Report
Pre-2010 Nomenclature: DRB1*1532 Local Names: DRB1*1501new
IMGT/HLA Acc No: HLA03635 OMIM Entry: *142857
Assigned: 2009-02-28 Sequence Last Modified: 2009-04-17
Source Entries: FJ668016  
Cells Sequence Derived From: 1-6117  
Known Ethnic Origin Of Source: Hispanic
CWD v2.0 Status: Not defined
Publications
Alaez C et al. Tissue Antigens 74:267-268 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEETVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGACCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo