Allele Report for DRB1*15:16

DRB1*15:16 View HGVS Report
Pre-2010 Nomenclature: DRB1*1516 Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA02008 OMIM Entry: *142857
Assigned: 2004-09-24 Sequence Last Modified: 2005-04-08
Source Entries: AY714542  
Cells Sequence Derived From: D086  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Hu ZH et al. Int J Immunogenet 32:221-2 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR15 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR15
Comments:
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVREFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGAGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo