Allele Report for DRB1*15:13

DRB1*15:13 View HGVS Report
Pre-2010 Nomenclature: DRB1*1513 Local Names: HLA-DRB1*TT68
IMGT/HLA Acc No: HLA01541 OMIM Entry: *142857
Assigned: 2001-10-31 Sequence Last Modified: 2002-01-11
Source Entries: AF239244  
Cells Sequence Derived From: TT68  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR2 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR2
Comments: NN: DR15 DR16 
Protein Sequence (87 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQDILEQARAAVDTYCRHNYGVV
ESFTVQR
Nucleotide Sequence Data (263 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTG
TGGAGAGCTTCACAGTGCAGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo