Allele Report for DRB1*15:10

DRB1*15:10 View HGVS Report
Pre-2010 Nomenclature: DRB1*1510 Local Names: 98-2028,098-2500
IMGT/HLA Acc No: HLA01211 OMIM Entry: *142857
Assigned: 2000-02-23 Sequence Last Modified: 2009-04-17
Source Entries: AF191104 , AF243536 , FJ688168  
Cells Sequence Derived From: 98-2028 , 98-2500 , BY00427 , GN00320  
Known Ethnic Origin Of Source: Caucasoid
Publications
Tang TF et al. Tissue Antigens 59:63-5 2002. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR2 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR2
Comments: NN: DR15  
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo