Allele Report for DRB1*15:06:01

DRB1*15:06:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*1506 Local Names: DRB1*1501Var, DRB1*15new
IMGT/HLA Acc No: HLA00873 OMIM Entry: *142857
Assigned: 1996-06-30 Sequence Last Modified: 2010-07-16
Source Entries: AY174180 , D63586 , GU991555 , JF275851 , U45999 , X98256  
Cells Sequence Derived From: BY00673 , CANSIN009 , CS00068 , INDRAN001 , INDRAN003 , INDRAN004 , JB317836 , P.M.DNA#22025 , RP  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
van den Berg-Loonen E et al. Tissue Antigens 49:189-91 1997. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 9 Laboratories: 6
HLA Dictionary Data
Expert Assigned Type: DR15 WHO Assigned Type: DR15(2)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 2 DR15 [100%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR15
Comments:
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAATELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGCGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo