Allele Report for DRB1*15:02:05

DRB1*15:02:05 View HGVS Report
Pre-2010 Nomenclature: DRB1*150205 Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA03254 OMIM Entry: *142857
Assigned: 2008-03-25 Sequence Last Modified: 2008-04-08
Source Entries: EU523122  
Cells Sequence Derived From: P2976  
Known Ethnic Origin Of Source: Oriental
Publications
Zhu FM et al. Tissue Antigens 74:173-175 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR15 WHO Assigned Type: DR15(2)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 17 DR15 [82-100%] DR2 [0-14%]
NMDP (2008) 676 DR15 [77%] DR2 [16%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR2 DR15
Comments:
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACGGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo