Allele Report for DRB1*15:02:02

DRB1*15:02:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*150202 Local Names: DRB1*15022, DR2DMU
IMGT/HLA Acc No: HLA00868 OMIM Entry: *142857
Assigned: 1993-11-08 Sequence Last Modified: 2006-01-12
Source Entries: AM110004 , L23964  
Cells Sequence Derived From: CMURD , THA  
Known Ethnic Origin Of Source: Caucasoid
Publications
Israel S et al. Tissue Antigens 49:173-5 1997. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR15 WHO Assigned Type: DR15(2)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 17 DR15 [82-100%] DR2 [0-14%]
NMDP (2008) 676 DR15 [77%] DR2 [16%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR2 DR15
Comments:
Protein Sequence (182 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
GESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVE
Nucleotide Sequence Data (549 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTATATCCTTCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGCTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCTGAACGGCCAGGAAGA
GAAGGCTGGGATGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGAAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGAAT
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo