Allele Report for DRB1*15:01:11

DRB1*15:01:11 View HGVS Report
Pre-2010 Nomenclature: DRB1*150111 Local Names: HIS_NEW_DR15_221_00011, HIS_NEW_DR15_425_00090
IMGT/HLA Acc No: HLA04656 OMIM Entry: *142857
Assigned: 2009-12-21 Sequence Last Modified: 2010-01-15
Source Entries: FJ358157 , FJ875603 , GQ900585 , HM187718 , HM187719 , HM187720 , HM187721 , HM187722 , HM562349 , HM562350 , JQ824725 , JQ824726  
Cells Sequence Derived From: HG00000400 , HG00001857 , HG00001858 , HG00001909 , HG00001910 , HG00001911 , HG00001912 , HG00005142 , HG00005143 , HN-55222-3 , HN-58560-0 , HN-62717-0  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 12 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TACAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo