Allele Report for DRB1*15:01:06

DRB1*15:01:06 View HGVS Report
Pre-2010 Nomenclature: DRB1*150106 Local Names: BY00109
IMGT/HLA Acc No: HLA02569 OMIM Entry: *142857
Assigned: 2006-05-31 Sequence Last Modified: 2006-07-14
Source Entries: DQ514601 , DQ514603 , EF078985 , EF156366  
Cells Sequence Derived From: BY00107 , BY00109 , BY00140 , BY00143  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Zhang B et al. Tissue Antigens 71:95-6 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR15 WHO Assigned Type: DR15(2)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 31 DR15 [75-90%] DR2 [0-19%] DR16 [0-13%]
NMDP (2008) 6428 DR15 [76%] DR2 [23%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR2 DR15
Comments:
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAATACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo