Allele Report for DRB1*15:01:05

DRB1*15:01:05 View HGVS Report
Pre-2010 Nomenclature: DRB1*150105 Local Names: DRB1*1501V2
IMGT/HLA Acc No: HLA01745 OMIM Entry: *142857
Assigned: 2003-05-22 Sequence Last Modified: 2003-07-12
Source Entries: AB106127  
Cells Sequence Derived From: TBC-B23250  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR15 WHO Assigned Type: DR15(2)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 31 DR15 [75-90%] DR2 [0-19%] DR16 [0-13%]
NMDP (2008) 6428 DR15 [76%] DR2 [23%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR2 DR15
Comments:
Protein Sequence (89 aa)
RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTTCAATGGGACCGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo