Allele Report for DRB1*14:99

DRB1*14:99 View HGVS Report
Pre-2010 Nomenclature: DRB1*1499 Local Names: HistoGenetics HIS_NEW_DRB1_448_00198
IMGT/HLA Acc No: HLA04782 OMIM Entry: *142857
Assigned: 2010-02-22 Sequence Last Modified: 2010-04-01
Source Entries: FJ898495 , FN421416 , GU128070 , HM159355 , HM467583  
Cells Sequence Derived From: 20091898 , HG00001837 , HG00001838 , HN-67814-6 , HN-76266-3  
Known Ethnic Origin Of Source: Oriental
Publications
Todorova K et al. Tissue Antigens 78:486-487 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGC
GGAGCACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTATTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo