Allele Report for DRB1*14:143

DRB1*14:143 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA10119 OMIM Entry: *142857
Assigned: 2013-08-31 Sequence Last Modified: 2013-10-11
Source Entries: KF413408 , KJ789160  
Cells Sequence Derived From: 13061928 , P08146  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Huo MR et al. Tissue Antigens 83:134-135 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGC
GGAGCACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTATTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo