Allele Report for DRB1*14:141

DRB1*14:141 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA09720 OMIM Entry: *142857
Assigned: 2013-06-26 Sequence Last Modified: 2013-10-11
Source Entries: HE820983 , JF827308 , KF270564  
Cells Sequence Derived From: 54005 , D11031172  , HN04  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (266 aa)
MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAVR
ELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRW
FRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPRGFLS
Nucleotide Sequence Data (801 bps)
ATGGTGTGTCTGAGGCTCCCTGGAGGCTCCTGCATGGCAGTTCTGACAGTGACACTGATGGTGCTGAGCTCCCCACTGGC
TTTGGCTGGGGACACCAGACCACGTTTCTTGGAGCTGCTTAAGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGC
GGTTCCTGGAGAGACACTTCCATAACCAGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGAGG
GAGCTGGGGCGGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCAGGTGGACAATTA
CTGCAGACACAACTACGGGGTTGGTGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAA
AGACCCAGCCCCTGCAGCACCACAACCTGCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGG
TTCCGGAATGGCCAGGAAGAGAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCT
GGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCA
CAGTGGAATGGAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGGGCTTTGTGCTGGGCCTGCTC
TTCCTTGGGGCCGGGCTGTTCATCTACTTCAGGAATCAGAAAGGACACTCTGGACTTCAGCCAAGAGGATTCCTGAGCTG
A
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo