Allele Report for DRB1*14:137N

DRB1*14:137N View HGVS Report
Pre-2010 Nomenclature: Local Names: D10016961
IMGT/HLA Acc No: HLA08909 OMIM Entry: *142857
Assigned: 2012-11-30 Sequence Last Modified: 2013-01-18
Source Entries: HE654765  
Cells Sequence Derived From: D10016961  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Zhang C et al. Tissue Antigens 82:201-202 2013. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (93 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEHWNSQKDLLEQKRGRGGHLLQTQLRG
CGELHSAAASPSX
Nucleotide Sequence Data (553 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGC
GGAGCACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGAGGTGGACACCTATTGCAGACACAACTACGGG
GTTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCA
CCACAACCTGCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAG
AGAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTT
CCTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGAATGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo