Allele Report for DRB1*14:101

DRB1*14:101 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DRB1_637_00283
IMGT/HLA Acc No: HLA06010 OMIM Entry: *142857
Assigned: 2010-10-31 Sequence Last Modified: 2011-01-14
Source Entries: FR693748 , GU128076 , GU590992 , JN406488  
Cells Sequence Derived From: FRFGR23357 , HG00002208 , HG00003422 , HN-22119-4  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEYWNSQKDLLERRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGC
GGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTATTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo