Allele Report for DRB1*14:01:02

DRB1*14:01:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*140102 Local Names: DRB1*14012, DRB1*14ML
IMGT/HLA Acc No: HLA01278 OMIM Entry: *142857
Assigned: 2000-06-20 Sequence Last Modified: 2010-07-16
Source Entries: AJ289123 , HM021741  
Cells Sequence Derived From: BV17214 , NT01162  
Known Ethnic Origin Of Source: Caucasoid
Publications
Tavoularis S et al. Tissue Antigens 63:496-500 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR14 WHO Assigned Type: DR14(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 18 DR14 [91-100%] DR6 [0-7%]
NMDP (2008) 1942 DR14 [74%] DR6 [14%] DR13 [3%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR6 DR14
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGC
GGAGCACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo