Allele Report for DRB1*14:95

DRB1*14:95 View HGVS Report
Pre-2010 Nomenclature: DRB1*1495 Local Names: HistoGenetics HIS_NEW_DRB1_269_00101
IMGT/HLA Acc No: HLA04614 OMIM Entry: *142857
Assigned: 2009-11-30 Sequence Last Modified: 2010-01-15
Source Entries: FJ502336 , HM594852 , HM594853 , HQ230553 , JN119524 , JN119525 , JQ824741  
Cells Sequence Derived From: HG00001900 , HG00002195 , HG00003410 , HG00003411 , HG00005163 , HG10011840 , HN-51663-1  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 7 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTATTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo