Allele Report for DRB1*14:86

DRB1*14:86 View HGVS Report
Pre-2010 Nomenclature: DRB1*1486 Local Names: 021084-CB
IMGT/HLA Acc No: HLA03764 OMIM Entry: *142857
Assigned: 2009-04-30 Sequence Last Modified: 2009-07-17
Source Entries: FN186134  
Cells Sequence Derived From: 021084-CB  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Frison S et al. Human Immunology 73:67-69 2012. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVRELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGAGGGAGCTGGGGCGGCCTGCTGC
GGAGCACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTATTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo