Allele Report for DRB1*14:85

DRB1*14:85 View HGVS Report
Pre-2010 Nomenclature: DRB1*1485 Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA03685 OMIM Entry: *142857
Assigned: 2009-03-31 Sequence Last Modified: 2009-07-17
Source Entries: AB485773  
Alignment of CDS Source Entries
DRB1*01:01:01
DRB1*14:85
Submission 1

Locus Reference
  Virtual entry for DRB1*14:85 
  Individual submission(s) 
Cells Sequence Derived From: K26647  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.3685 (Allele OID)
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPSAEYWNSQKDLLEDRRALVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAAGACAGGCGGGCCCTGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors