Allele Report for DRB1*14:78

DRB1*14:78 View HGVS Report
Pre-2010 Nomenclature: DRB1*1478 Local Names: HLA-DRB1*14new
IMGT/HLA Acc No: HLA03309 OMIM Entry: *142857
Assigned: 2008-04-29 Sequence Last Modified: 2008-10-10
Source Entries: EU588391  
Cells Sequence Derived From: HistoCB69685  
Known Ethnic Origin Of Source: Oriental
Publications
Han S et al. Tissue Antigens 73:81-3 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPSAEYWNSQKDILEDRRALVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACAGGCGGGCCCTGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo