Allele Report for DRB1*14:75

DRB1*14:75 View HGVS Report
Pre-2010 Nomenclature: DRB1*1475 Local Names: HLA-DRB1*14new
IMGT/HLA Acc No: HLA03194 OMIM Entry: *142857
Assigned: 2007-12-20 Sequence Last Modified: 2008-01-11
Source Entries: AM922324  
Cells Sequence Derived From: 2647934  
Known Ethnic Origin Of Source: Caucasoid
Publications
Schuett S et al. Tissue Antigens 72:501-2 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEHWNSQKDLLERRRAEVDTYCRYNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGC
GGAGCACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTACTGCAGATACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo