Allele Report for DRB1*14:49

DRB1*14:49 View HGVS Report
Pre-2010 Nomenclature: DRB1*1449 Local Names: HLA-DRB1* 14 variant
IMGT/HLA Acc No: HLA02131 OMIM Entry: *142857
Assigned: 2005-02-18 Sequence Last Modified: 2005-07-12
Source Entries: AY912075 , DQ882243  
Cells Sequence Derived From: BY00127 , NJ5627  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR14 WHO Assigned Type: DR14(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR14
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVTELGRPAAEHWNSQKDLLEQRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGC
GGAGCACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo