Allele Report for DRB1*14:48

DRB1*14:48 View HGVS Report
Pre-2010 Nomenclature: DRB1*1448 Local Names: BY00051
IMGT/HLA Acc No: HLA01734 OMIM Entry: *142857
Assigned: 2003-04-30 Sequence Last Modified: 2003-07-12
Source Entries: AY267906 , EU812545  
Cells Sequence Derived From: BY00051 , NT00981  
Known Ethnic Origin Of Source: Hispanic
CWD v2.0 Status: Not defined
Publications
Lazaro AM et al. Tissue Antigens 66:327-9 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR14 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR14
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo