Allele Report for DRB1*14:41

DRB1*14:41 View HGVS Report
Pre-2010 Nomenclature: DRB1*1441 Local Names: 04RCH28new
IMGT/HLA Acc No: HLA01500 OMIM Entry: *142857
Assigned: 2001-08-29 Sequence Last Modified: 2001-10-26
Source Entries: AF339884 , AY050186  
Cells Sequence Derived From: 04RCH28  
Known Ethnic Origin Of Source: Mixed
CWD v2.0 Status: Not defined
Publications
Gans CP et al. Tissue Antigens 59:364-9 2002. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 1 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR14 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR14
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLERYFHNQEEFLRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (269 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTC
CATAACCAGGAGGAGTTCCTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo